General Information

  • ID:  hor001489
  • Uniprot ID:  Q9GM96
  • Protein name:  Neuropeptide NPSF
  • Gene name:  NPVF
  • Organism:  Bos taurus (Bovine)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0032277 negative regulation of gonadotropin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLTFEEVKDWAPKIKMNKPVVNKMPPSAANLPLRF
  • Length:  35
  • Propeptide:  MEIISLKRFILLMLATSSLLTSNIFCTDESRMPNLYSKKNYDKYSEPRGDLGWEKERSLTFEEVKDWAPKIKMNKPVVNKMPPSAANLPLRFGRNMEEERSTRAMAHLPLRLGKNREDSLSRWVPNLPQRFGRTTTAKSITKTLSNLLQQSMHSPSTNGLLYSMACQPQEIQNPGQKNLRRRGFQKIDDAELKQEK
  • Signal peptide:  MEIISLKRFILLMLATSSLLT
  • Modification:  T35 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPFFR1
  • Target Unid:  F1N1Y7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81277-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P81277-F1.pdbhor001489_AF2.pdbhor001489_ESM.pdb

Physical Information

Mass: 460439 Formula: C184H295N47O48S2
Absent amino acids: CGHQY Common amino acids: KP
pI: 10.62 Basic residues: 6
Polar residues: 6 Hydrophobic residues: 13
Hydrophobicity: -36.86 Boman Index: -4408
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 8816.29 Extinction Coefficient cystines: 5500
Absorbance 280nm: 161.76

Literature

  • PubMed ID:  11583817
  • Title:  Characteristics and distribution of endogenous RFamide-related peptide-1.